VPS8 anticorps

N° du produit ABIN631659

Détail du produit anti-VPS8 anticorps

Antigène: VPS8 (Vacuolar Protein Sorting 8 Homolog (VPS8))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPS8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: VPS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDDPTLAICNDSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPS8 Blocking Peptide, catalog no. 33R-1696, is also available for use as a blocking control in assays to test for specificity of this VPS8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPS8

Antigène: VPS8 (Vacuolar Protein Sorting 8 Homolog (VPS8))

Autre désignation: VPS8 (VPS8 Produits)

Synonymes: anticorps si:dkey-24b15.1, anticorps zgc:158695, anticorps KIAA0804, anticorps AI315068, anticorps AU040738, anticorps mKIAA0804, anticorps RGD1309443, anticorps VPS8, CORVET complex subunit, anticorps vacuolar protein sorting 8 homolog (S. cerevisiae), anticorps VPS8 CORVET complex subunit, anticorps vps8, anticorps VPS8, anticorps Vps8

Sujet: VPS8 belongs to the VPS8 family. It contains 1 RING-type zinc finger and 1 WD repeat. The functions of VPS8 remain unknown.

Poids moléculaire: 162 kDa (MW of target protein)