ACTN1 anticorps (N-Term)

N° du produit ABIN631669

Détail du produit anti-ACTN1 anticorps

Antigène: ACTN1 (Actinin, alpha 1 (ACTN1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Alpha Actinin 1 antibody was raised against the N terminal of ACTN1

Purification: Affinity purified

Immunogène: alpha Actinin 1 antibody was raised using the N terminal of ACTN1 corresponding to a region with amino acids DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Alpha Actinin 1 Blocking Peptide, catalog no. 33R-1985, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTN1

Antigène: ACTN1 (Actinin, alpha 1 (ACTN1))

Autre désignation: alpha Actinin 1 (ACTN1 Produits)

Synonymes: anticorps ACTN1, anticorps actinin, anticorps BDPLT15, anticorps 3110023F10Rik, anticorps Actn1a, anticorps actinin alpha 1, anticorps actinin, alpha 1, anticorps actinin alpha 1 L homeolog, anticorps ACTN1, anticorps actn1, anticorps Actn1, anticorps actn1.L

Sujet: Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments.

Poids moléculaire: 103 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization