TSR1 anticorps

N° du produit ABIN631738

Détail du produit anti-TSR1 anticorps

Antigène: TSR1 (TSR1, 20S rRNA Accumulation, Homolog (TSR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSR1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TSR1 Blocking Peptide, catalog no. 33R-5698, is also available for use as a blocking control in assays to test for specificity of this TSR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSR1

Antigène: TSR1 (TSR1, 20S rRNA Accumulation, Homolog (TSR1))

Autre désignation: TSR1 (TSR1 Produits)

Synonymes: anticorps AU040765, anticorps AW550801, anticorps mKIAA1401, anticorps TSR1 20S rRNA accumulation, anticorps TSR1, ribosome maturation factor L homeolog, anticorps TSR1, ribosome maturation factor, anticorps Tsr1, anticorps tsr1.L, anticorps TSR1

Sujet: TSR1 belongs to the BMS1/TSR1 family and TSR1 subfamily. TSR1 is required during maturation of the 40S ribosomal subunit in the nucleolus.

Poids moléculaire: 92 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly