TSPY-Like 4 anticorps (Middle Region)
-
- Antigène Tous les produits TSPY-Like 4 (TSPYL4)
- TSPY-Like 4 (TSPYL4)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TSPY-Like 4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TSPYL4 antibody was raised against the middle region of TSPYL4
- Purification
- Affinity purified
- Immunogène
- TSPYL4 antibody was raised using the middle region of TSPYL4 corresponding to a region with amino acids QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TSPYL4 Blocking Peptide, catalog no. 33R-7599, is also available for use as a blocking control in assays to test for specificity of this TSPYL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPYL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TSPY-Like 4 (TSPYL4)
- Autre désignation
- TSPYL4 (TSPYL4 Produits)
- Synonymes
- anticorps dJ486I3.2, anticorps 2610102M01Rik, anticorps B230210I21Rik, anticorps D10Bwg0791e, anticorps TSPY like 4, anticorps TSPY-like 4, anticorps TSPYL4, anticorps Tspyl4
- Sujet
- TSPYL4 belongs to the nucleosome assembly protein (NAP) family. The functions of TSPYL4 remain unknown.
- Poids moléculaire
- 45 kDa (MW of target protein)
-