TSPY-Like 4 anticorps (Middle Region)

N° du produit ABIN631764

Détail du produit anti-TSPY-Like 4 anticorps

Antigène: TSPY-Like 4 (TSPYL4)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSPY-Like 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: TSPYL4 antibody was raised against the middle region of TSPYL4

Purification: Affinity purified

Immunogène: TSPYL4 antibody was raised using the middle region of TSPYL4 corresponding to a region with amino acids QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TSPYL4 Blocking Peptide, catalog no. 33R-7599, is also available for use as a blocking control in assays to test for specificity of this TSPYL4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPYL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSPY-Like 4

Antigène: TSPY-Like 4 (TSPYL4)

Autre désignation: TSPYL4 (TSPYL4 Produits)

Synonymes: anticorps dJ486I3.2, anticorps 2610102M01Rik, anticorps B230210I21Rik, anticorps D10Bwg0791e, anticorps TSPY like 4, anticorps TSPY-like 4, anticorps TSPYL4, anticorps Tspyl4

Sujet: TSPYL4 belongs to the nucleosome assembly protein (NAP) family. The functions of TSPYL4 remain unknown.

Poids moléculaire: 45 kDa (MW of target protein)