SHMT2 anticorps
-
- Antigène Voir toutes SHMT2 Anticorps
- SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SHMT2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE
- Top Product
- Discover our top product SHMT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SHMT2 Blocking Peptide, catalog no. 33R-2579, is also available for use as a blocking control in assays to test for specificity of this SHMT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHMT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))
- Autre désignation
- SHMT2 (SHMT2 Produits)
- Synonymes
- anticorps GLYA, anticorps SHMT, anticorps 2700043D08Rik, anticorps AA408223, anticorps AA986903, anticorps serine hydroxymethyltransferase 2, anticorps serine hydroxymethyltransferase 2 (mitochondrial), anticorps serine hydroxymethyltransferase 2 (mitochondrial) L homeolog, anticorps serine hydroxymethyltransferase, mitochondrial-like, anticorps SHMT2, anticorps Chro.80302, anticorps Shmt2, anticorps shmt2, anticorps shmt2.L, anticorps SHMT
- Sujet
- SHMT2 plays a role in interconversion of serine and glycine.
- Poids moléculaire
- 56 kDa (MW of target protein)
-