APOH anticorps

N° du produit ABIN631792

Détail du produit anti-APOH anticorps

Antigène: APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APOH est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ApoH Blocking Peptide, catalog no. 33R-7270, is also available for use as a blocking control in assays to test for specificity of this ApoH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APOH

Antigène: APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))

Autre désignation: ApoH (APOH Produits)

Synonymes: anticorps B2G1, anticorps B2GP1, anticorps BG, anticorps BETA2, anticorps BHF-1, anticorps MODY6, anticorps NEUROD, anticorps bHLHa3, anticorps apoh, anticorps APOH, anticorps B2GPI, anticorps beta-2-GPI, anticorps beta2-GPI, anticorps LOC100227913, anticorps apolipoprotein H, anticorps neuronal differentiation 1, anticorps APOH, anticorps NEUROD1, anticorps apoh, anticorps Apoh

Sujet: Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies.

Poids moléculaire: 36 kDa (MW of target protein)