RSL24D1 anticorps (Middle Region)

N° du produit ABIN631795

Détail du produit anti-RSL24D1 anticorps

Antigène: RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RSL24D1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C15 ORF15 antibody was raised against the middle region of C15 rf15

Purification: Affinity purified

Immunogène: C15 ORF15 antibody was raised using the middle region of C15 rf15 corresponding to a region with amino acids KCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C15ORF15 Blocking Peptide, catalog no. 33R-4271, is also available for use as a blocking control in assays to test for specificity of this C15ORF15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RSL24D1

Antigène: RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))

Autre désignation: C15ORF15 (RSL24D1 Produits)

Synonymes: anticorps C15orf15, anticorps HRP-L30-iso, anticorps L30, anticorps RLP24, anticorps RPL24, anticorps RPL24L, anticorps TVAS3, anticorps 2410159K22Rik, anticorps RGD1309784, anticorps c15orf15, anticorps wu:fa94f12, anticorps wu:fa95d02, anticorps zgc:56202, anticorps ribosomal L24 domain containing 1, anticorps RSL24D1, anticorps Rsl24d1, anticorps rsl24d1

Sujet: This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals.

Poids moléculaire: 19 kDa (MW of target protein)