TSGA13 anticorps (Middle Region)

N° du produit ABIN631851

Détail du produit anti-TSGA13 anticorps

Antigène: TSGA13 (Testis Specific, 13 (TSGA13))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSGA13 est non-conjugé

Application: Western Blotting (WB)

Specificité: TSGA13 antibody was raised against the middle region of TSGA13

Purification: Affinity purified

Immunogène: TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TSGA13 Blocking Peptide, catalog no. 33R-1503, is also available for use as a blocking control in assays to test for specificity of this TSGA13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSGA13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSGA13

Antigène: TSGA13 (Testis Specific, 13 (TSGA13))

Autre désignation: TSGA13 (TSGA13 Produits)

Synonymes: anticorps 1700023D02Rik, anticorps Vme1, anticorps testis specific gene A13, anticorps testis specific 13, anticorps Tsga13, anticorps TSGA13

Sujet: The specific function of TSGA13 is not yet known.

Poids moléculaire: 32 kDa (MW of target protein)