CYB5D1 anticorps (Middle Region)

N° du produit ABIN631853

Détail du produit anti-CYB5D1 anticorps

Antigène: CYB5D1 (Cytochrome B5 Domain Containing 1 (CYB5D1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYB5D1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYB5 D1 antibody was raised against the middle region of CYB5 1

Purification: Affinity purified

Immunogène: CYB5 D1 antibody was raised using the middle region of CYB5 1 corresponding to a region with amino acids KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYB5D1 Blocking Peptide, catalog no. 33R-4736, is also available for use as a blocking control in assays to test for specificity of this CYB5D1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYB0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYB5D1

Antigène: CYB5D1 (Cytochrome B5 Domain Containing 1 (CYB5D1))

Autre désignation: CYB5D1 (CYB5D1 Produits)

Synonymes: anticorps RGD1559567, anticorps MGC146746, anticorps DKFZp459B103, anticorps Gm740, anticorps zgc:112008, anticorps cytochrome b5 domain containing 1, anticorps cytochrome b5 domain containing 1 L homeolog, anticorps Cyb5d1, anticorps cyb5d1.L, anticorps CYB5D1, anticorps cyb5d1

Sujet: The function of CYB protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 27 kDa (MW of target protein)