TOM1L2 anticorps

N° du produit ABIN631872

Détail du produit anti-TOM1L2 anticorps

Antigène: TOM1L2 (Target of Myb1-Like 2 (TOM1L2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TOM1L2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TOM1 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TOM1L2 Blocking Peptide, catalog no. 33R-7685, is also available for use as a blocking control in assays to test for specificity of this TOM1L2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TOM1L2

Antigène: TOM1L2 (Target of Myb1-Like 2 (TOM1L2))

Autre désignation: TOM1L2 (TOM1L2 Produits)

Synonymes: anticorps 2900016I08Rik, anticorps A730055F12Rik, anticorps AU042072, anticorps Srebf1, anticorps target of myb1 like 2 membrane trafficking protein, anticorps target of myb1 like 2 membrane trafficking protein L homeolog, anticorps target of myb1-like 2 (chicken), anticorps TOM1L2, anticorps tom1l2.L, anticorps Tom1l2

Sujet: TOM1L2 may regulate growth factor-induced mitogenic signaling.

Poids moléculaire: 55 kDa (MW of target protein)