APOBEC4 anticorps
-
- Antigène Voir toutes APOBEC4 Anticorps
- APOBEC4 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp APOBEC4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ApoBEC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL
- Top Product
- Discover our top product APOBEC4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ApoBEC4 Blocking Peptide, catalog no. 33R-5110, is also available for use as a blocking control in assays to test for specificity of this ApoBEC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- APOBEC4 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4))
- Autre désignation
- ApoBEC4 (APOBEC4 Produits)
- Synonymes
- anticorps C1orf169, anticorps 4933431M11Rik, anticorps apolipoprotein B mRNA editing enzyme catalytic polypeptide like 4, anticorps apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative), anticorps APOBEC4, anticorps Apobec4
- Sujet
- APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.
- Poids moléculaire
- 41 kDa (MW of target protein)
-