C21orf91 anticorps (Middle Region)

N° du produit ABIN631903

Détail du produit anti-C21orf91 anticorps

Antigène: C21orf91 (Chromosome 21 Open Reading Frame 91 (C21orf91))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C21orf91 est non-conjugé

Application: Western Blotting (WB)

Specificité: C21 ORF91 antibody was raised against the middle region of C21 rf91

Purification: Affinity purified

Immunogène: C21 ORF91 antibody was raised using the middle region of C21 rf91 corresponding to a region with amino acids LCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C21ORF91 Blocking Peptide, catalog no. 33R-4830, is also available for use as a blocking control in assays to test for specificity of this C21ORF91 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF91 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C21orf91

Antigène: C21orf91 (Chromosome 21 Open Reading Frame 91 (C21orf91))

Autre désignation: C21ORF91 (C21orf91 Produits)

Synonymes: anticorps C21orf14, anticorps C21orf38, anticorps CSSG1, anticorps EURL, anticorps YG81, anticorps C21orf91, anticorps 1700010I10Rik, anticorps 2310009O17Rik, anticorps E330003K22Rik, anticorps Eurl, anticorps eurl, anticorps chromosome 21 open reading frame 91, anticorps chromosome 1 open reading frame, human C21orf91, anticorps chromosome 3 open reading frame, human C21orf91, anticorps chromosome 21 open reading frame 91 L homeolog, anticorps DNA segment, Chr 16, ERATO Doi 472, expressed, anticorps zgc:110006, anticorps C21orf91, anticorps C1H21ORF91, anticorps C3H21orf91, anticorps c21orf91.L, anticorps c21orf91, anticorps C1H21orf91, anticorps D16Ertd472e, anticorps zgc:110006

Sujet: The function of C21orf91 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 34 kDa (MW of target protein)