ASPA anticorps

N° du produit ABIN631906

Détail du produit anti-ASPA anticorps

Antigène: ASPA (Aspartoacylase (ASPA))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASPA est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ASPA antibody was raised using a synthetic peptide corresponding to a region with amino acids RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASPA Blocking Peptide, catalog no. 33R-7964, is also available for use as a blocking control in assays to test for specificity of this ASPA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASPA

Antigène: ASPA (Aspartoacylase (ASPA))

Autre désignation: ASPA (ASPA Produits)

Synonymes: anticorps asp, anticorps acy2, anticorps ACY-2, anticorps ASP, anticorps ACY2, anticorps Acy-2, anticorps Acy2, anticorps nur7, anticorps zgc:171507, anticorps aspartoacylase, anticorps Aspartoacylase, anticorps ASPA, anticorps aspa, anticorps Fbal_2465, anticorps Aspa

Sujet: The specific function of SASP is not yet known.

Poids moléculaire: 36 kDa (MW of target protein)