SLAIN1 anticorps (Middle Region)

N° du produit ABIN631967

Détail du produit anti-SLAIN1 anticorps

Antigène: SLAIN1 (SLAIN Motif Family, Member 1 (SLAIN1))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLAIN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLAIN1 antibody was raised against the middle region of SLAIN1

Purification: Affinity purified

Immunogène: SLAIN1 antibody was raised using the middle region of SLAIN1 corresponding to a region with amino acids RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLAIN1 Blocking Peptide, catalog no. 33R-8203, is also available for use as a blocking control in assays to test for specificity of this SLAIN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLAIN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLAIN1

Antigène: SLAIN1 (SLAIN Motif Family, Member 1 (SLAIN1))

Autre désignation: SLAIN1 (SLAIN1 Produits)

Synonymes: anticorps 9630044O09Rik, anticorps AA675320, anticorps AW742596, anticorps C13orf32, anticorps RGD1308626, anticorps zgc:175146, anticorps SLAIN motif family member 1, anticorps SLAIN motif family, member 1, anticorps SLAIN motif family, member 1b, anticorps SLAIN1, anticorps Slain1, anticorps slain1b

Sujet: The function of SLAIN1 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 38 kDa (MW of target protein)