FAM76B anticorps (Middle Region)

N° du produit ABIN631968

Détail du produit anti-FAM76B anticorps

Antigène: FAM76B (Family with Sequence Similarity 76, Member B (FAM76B))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM76B est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM76 B antibody was raised against the middle region of FAM76

Purification: Affinity purified

Immunogène: FAM76 B antibody was raised using the middle region of FAM76 corresponding to a region with amino acids QQCAFDRKEEGRRKVDGKLLCWLCTLSYKRVLQKTKEQRKSLGSSHSNSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM76B Blocking Peptide, catalog no. 33R-7689, is also available for use as a blocking control in assays to test for specificity of this FAM76B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM76B

Antigène: FAM76B (Family with Sequence Similarity 76, Member B (FAM76B))

Autre désignation: FAM76B (FAM76B Produits)

Synonymes: anticorps fa11h02, anticorps wu:fa11h02, anticorps zgc:73333, anticorps 2810485I05Rik, anticorps C78303, anticorps RGD1311077, anticorps family with sequence similarity 76 member B, anticorps family with sequence similarity 76, member B, anticorps family with sequence similarity 76 member B S homeolog, anticorps FAM76B, anticorps fam76b, anticorps fam76b.S, anticorps Fam76b

Sujet: FAM76B belongs to the FAM76 family. The function of the FAM76B protein remains unknown.

Poids moléculaire: 39 kDa (MW of target protein)