FAM76B anticorps (Middle Region)
-
- Antigène Tous les produits FAM76B
- FAM76B (Family with Sequence Similarity 76, Member B (FAM76B))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM76B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAM76 B antibody was raised against the middle region of FAM76
- Purification
- Affinity purified
- Immunogène
- FAM76 B antibody was raised using the middle region of FAM76 corresponding to a region with amino acids QQCAFDRKEEGRRKVDGKLLCWLCTLSYKRVLQKTKEQRKSLGSSHSNSS
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM76B Blocking Peptide, catalog no. 33R-7689, is also available for use as a blocking control in assays to test for specificity of this FAM76B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM76B (Family with Sequence Similarity 76, Member B (FAM76B))
- Autre désignation
- FAM76B (FAM76B Produits)
- Synonymes
- anticorps fa11h02, anticorps wu:fa11h02, anticorps zgc:73333, anticorps 2810485I05Rik, anticorps C78303, anticorps RGD1311077, anticorps family with sequence similarity 76 member B, anticorps family with sequence similarity 76, member B, anticorps family with sequence similarity 76 member B S homeolog, anticorps FAM76B, anticorps fam76b, anticorps fam76b.S, anticorps Fam76b
- Sujet
- FAM76B belongs to the FAM76 family. The function of the FAM76B protein remains unknown.
- Poids moléculaire
- 39 kDa (MW of target protein)
-