N6AMT1 anticorps

N° du produit ABIN632001

Détail du produit anti-N6AMT1 anticorps

Antigène: N6AMT1 (N-6 Adenine-Specific DNA Methyltransferase 1 (Putative) (N6AMT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp N6AMT1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: N6 AMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

N6AMT1 Blocking Peptide, catalog no. 33R-5659, is also available for use as a blocking control in assays to test for specificity of this N6AMT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of N0 MT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur N6AMT1

Antigène: N6AMT1 (N-6 Adenine-Specific DNA Methyltransferase 1 (Putative) (N6AMT1))

Autre désignation: N6AMT1 (N6AMT1 Produits)

Synonymes: anticorps HEMK2, anticorps C21orf127, anticorps N6AMT1, anticorps MTQ2, anticorps N6AMT, anticorps 5830445C04Rik, anticorps Hemk2, anticorps Pred28, anticorps RGD1311843, anticorps N-6 adenine-specific DNA methyltransferase 1 (putative), anticorps N-6 adenine-specific DNA methyltransferase 1, anticorps HemK methyltransferase family member 2, anticorps uncharacterized LOC100283871, anticorps N6AMT1, anticorps CpipJ_CPIJ001152, anticorps LOC100283871, anticorps N6amt1

Sujet: The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Poids moléculaire: 20 kDa (MW of target protein)