NOC3L anticorps

N° du produit ABIN632009

Détail du produit anti-NOC3L anticorps

Antigène: NOC3L (Nucleolar Complex Associated 3 Homolog (NOC3L))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOC3L est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NOC3 L antibody was raised using a synthetic peptide corresponding to a region with amino acids TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOC3L Blocking Peptide, catalog no. 33R-9174, is also available for use as a blocking control in assays to test for specificity of this NOC3L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOC3L

Antigène: NOC3L (Nucleolar Complex Associated 3 Homolog (NOC3L))

Autre désignation: NOC3L (NOC3L Produits)

Synonymes: anticorps AD24, anticorps C10orf117, anticorps FAD24, anticorps AF233884, anticorps Fad24, anticorps RGD1560656, anticorps NOC3 protein homolog, anticorps c10orf117, anticorps cb522, anticorps sb:cb522, anticorps NOC3 like DNA replication regulator, anticorps NOC3-like DNA replication regulator S homeolog, anticorps NOC3-like DNA replication regulator, anticorps nucleolar complex associated 3 homolog (S. cerevisiae), anticorps NOC3L, anticorps Noc3l, anticorps noc3l.S, anticorps noc3l

Sujet: NOC3L belongs to the CBF/MAK21 family. It may be required for adipogenesis.

Poids moléculaire: 92 kDa (MW of target protein)