ASPRV1 anticorps (Middle Region)

N° du produit ABIN632022

Détail du produit anti-ASPRV1 anticorps

Antigène: ASPRV1 (Aspartic Peptidase, Retroviral-Like 1 (ASPRV1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASPRV1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SASP antibody was raised against the middle region of Sasp

Purification: Affinity purified

Immunogène: SASP antibody was raised using the middle region of Sasp corresponding to a region with amino acids RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SASP Blocking Peptide, catalog no. 33R-7921, is also available for use as a blocking control in assays to test for specificity of this SASP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SASP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASPRV1

Antigène: ASPRV1 (Aspartic Peptidase, Retroviral-Like 1 (ASPRV1))

Autre désignation: SASP (ASPRV1 Produits)

Synonymes: anticorps MUNO, anticorps SASP, anticorps SASPase, anticorps Taps, anticorps 2300003P22Rik, anticorps AA986851, anticorps RGD1560859, anticorps aspartic peptidase retroviral like 1, anticorps aspartic peptidase, retroviral-like 1, anticorps ASPRV1, anticorps Asprv1

Sujet: The specific function of SASP is not yet known.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cell RedoxHomeostasis