NDUFS1 anticorps (Middle Region)

N° du produit ABIN632032

Détail du produit anti-NDUFS1 anticorps

Antigène: NDUFS1 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 1, 75kDa (NADH-Coenzyme Q Reductase) (NDUFS1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDUFS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NDUFS1 antibody was raised against the middle region of NDUFS1

Purification: Affinity purified

Immunogène: NDUFS1 antibody was raised using the middle region of NDUFS1 corresponding to a region with amino acids TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDUFS1 Blocking Peptide, catalog no. 33R-9227, is also available for use as a blocking control in assays to test for specificity of this NDUFS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NDUFS1

Antigène: NDUFS1 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 1, 75kDa (NADH-Coenzyme Q Reductase) (NDUFS1))

Autre désignation: NDUFS1 (NDUFS1 Produits)

Synonymes: anticorps 5830412M15Rik, anticorps 9930026A05Rik, anticorps CI-75Kd, anticorps CI-75k, anticorps PRO1304, anticorps NADH dehydrogenase (ubiquinone) Fe-S protein 1, anticorps NADH:ubiquinone oxidoreductase core subunit S1, anticorps Ndufs1, anticorps NDUFS1

Sujet: The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.

Poids moléculaire: 77 kDa (MW of target protein)