STK16 anticorps (Middle Region)

N° du produit ABIN632056

Détail du produit anti-STK16 anticorps

Antigène: STK16 (serine/threonine Kinase 16 (STK16))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STK16 est non-conjugé

Application: Western Blotting (WB)

Specificité: STK16 antibody was raised against the middle region of STK16

Purification: Affinity purified

Immunogène: STK16 antibody was raised using the middle region of STK16 corresponding to a region with amino acids TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STK16 Blocking Peptide, catalog no. 33R-9027, is also available for use as a blocking control in assays to test for specificity of this STK16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STK16

Antigène: STK16 (serine/threonine Kinase 16 (STK16))

Autre désignation: STK16 (STK16 Produits)

Synonymes: anticorps stk16, anticorps STK16, anticorps Stk16, anticorps ACYPI000353, anticorps KRCT, anticorps MPSK, anticorps PKL12, anticorps TSF1, anticorps EDPK, anticorps Krct, anticorps TSF-1, anticorps F52, anticorps serine/threonine kinase 16, anticorps serine/threonine kinase 16 L homeolog, anticorps serine/threonine-protein kinase, anticorps STK16, anticorps stk16.L, anticorps stk16, anticorps Stk16

Sujet: STK16 is a protein kinase that acts on both serine and threonine residues.

Poids moléculaire: 35 kDa (MW of target protein)