PSMB6 anticorps

N° du produit ABIN632097

Détail du produit anti-PSMB6 anticorps

Antigène: PSMB6 (Proteasome (Prosome, Macropain) Subunit, beta Type, 6 (PSMB6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMB6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PSMB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMB6 Blocking Peptide, catalog no. 33R-9319, is also available for use as a blocking control in assays to test for specificity of this PSMB6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMB6

Antigène: PSMB6 (Proteasome (Prosome, Macropain) Subunit, beta Type, 6 (PSMB6))

Autre désignation: PSMB6 (PSMB6 Produits)

Synonymes: anticorps Lmp19, anticorps Mpnd, anticorps Psmb6l, anticorps DELTA, anticorps LMPY, anticorps Y, anticorps y, anticorps zgc:109823, anticorps proteasome (prosome, macropain) subunit, beta type 6, anticorps proteasome subunit beta 6, anticorps Psmb6, anticorps PSMB6, anticorps psmb6

Sujet: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA