RAI14 anticorps (Middle Region)

N° du produit ABIN632115

Détail du produit anti-RAI14 anticorps

Antigène: RAI14 (Retinoic Acid Induced 14 (RAI14))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAI14 est non-conjugé

Application: Western Blotting (WB)

Specificité: RAI14 antibody was raised against the middle region of RAI14

Purification: Affinity purified

Immunogène: RAI14 antibody was raised using the middle region of RAI14 corresponding to a region with amino acids LSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAI14 Blocking Peptide, catalog no. 33R-5446, is also available for use as a blocking control in assays to test for specificity of this RAI14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAI14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAI14

Antigène: RAI14 (Retinoic Acid Induced 14 (RAI14))

Autre désignation: RAI14 (RAI14 Produits)

Synonymes: anticorps RAI14, anticorps NORPEG, anticorps RAI13, anticorps 1700008J19Rik, anticorps 1700020L11Rik, anticorps Ankycorbin, anticorps Norpeg, anticorps mKIAA1334, anticorps retinoic acid induced 14, anticorps ankycorbin, anticorps RAI14, anticorps rai14, anticorps LOC100541535, anticorps Rai14

Sujet: RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.

Poids moléculaire: 110 kDa (MW of target protein)