RAI14 anticorps (Middle Region)

N° du produit ABIN632115

Cet anticorps anti-RAI14 Polyclonal Lapin (ABIN632115) détecte spécifiquement RAI14 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour RAI14 anticorps (Middle Region) (ABIN632115)

Antigène: RAI14 (Retinoic Acid Induced 14 (RAI14))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAI14 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAI14 anticorps

Épitope: Middle Region

Specificité: RAI14 antibody was raised against the middle region of RAI14

Purification: Affinity purified

Immunogène: RAI14 antibody was raised using the middle region of RAI14 corresponding to a region with amino acids LSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAI14 Blocking Peptide, (ABIN5615746), is also available for use as a blocking control in assays to test for specificity of this RAI14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAI14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAI14

Antigène: RAI14 (Retinoic Acid Induced 14 (RAI14))

Autre désignation: RAI14

Sujet: RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.

Poids moléculaire: 110 kDa (MW of target protein)