PDXK anticorps

N° du produit ABIN632138

Détail du produit anti-PDXK anticorps

Antigène: PDXK (Pyridoxal Kinase (PDXK))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDXK est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PDXK antibody was raised using a synthetic peptide corresponding to a region with amino acids PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDXK Blocking Peptide, catalog no. 33R-7204, is also available for use as a blocking control in assays to test for specificity of this PDXK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDXK

Antigène: PDXK (Pyridoxal Kinase (PDXK))

Autre désignation: PDXK (PDXK Produits)

Synonymes: anticorps C21orf124, anticorps C21orf97, anticorps PKH, anticorps PNK, anticorps 2310036D04Rik, anticorps AA119688, anticorps C77999, anticorps Pdxk, anticorps PSPTO5521, anticorps DDBDRAFT_0190079, anticorps DDBDRAFT_0191114, anticorps DDB_0190079, anticorps DDB_0191114, anticorps ATSOS4, anticorps K18L3.1, anticorps K18L3_1, anticorps SALT OVERLY SENSITIVE 4, anticorps pdxk, anticorps si:dkey-263m10.2, anticorps si:dz69g10.1, anticorps cb1056, anticorps pdxkl, anticorps si:dkey-281i8.2, anticorps wu:fa55a03, anticorps wu:fb10c12, anticorps zgc:101900, anticorps pyridoxal kinase, anticorps pyridoxal (pyridoxine, vitamin B6) kinase, anticorps Pyridoxal kinase, anticorps pfkB-like carbohydrate kinase family protein, anticorps pyridoxal (pyridoxine, vitamin B6) kinase b, anticorps pyridoxal (pyridoxine, vitamin B6) kinase a, anticorps PDXK, anticorps Pdxk, anticorps pdxY, anticorps pdxK, anticorps Bphyt_1541, anticorps pykA, anticorps Kfla_4736, anticorps Kvar_1290, anticorps Mrub_2507, anticorps BC1002_1103, anticorps Fbal_1661, anticorps Lbys_0710, anticorps Intca_0131, anticorps Deima_3190, anticorps Mesop_1158, anticorps LOC100283562, anticorps pdxk, anticorps SOS4, anticorps pdxkb, anticorps pdxka

Sujet: PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer.

Poids moléculaire: 34 kDa (MW of target protein)