SS18L1 anticorps (Middle Region)

N° du produit ABIN632142

Détail du produit anti-SS18L1 anticorps

Antigène: SS18L1 (Synovial Sarcoma Translocation Gene On Chromosome 18-Like 1 (SS18L1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SS18L1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SS18 L1 antibody was raised against the middle region of SS18 1

Purification: Affinity purified

Immunogène: SS18 L1 antibody was raised using the middle region of SS18 1 corresponding to a region with amino acids EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SS18L1 Blocking Peptide, catalog no. 33R-2833, is also available for use as a blocking control in assays to test for specificity of this SS18L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SS10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SS18L1

Antigène: SS18L1 (Synovial Sarcoma Translocation Gene On Chromosome 18-Like 1 (SS18L1))

Autre désignation: SS18L1 (SS18L1 Produits)

Synonymes: anticorps crest, anticorps CREST, anticorps LP2261, anticorps A230053O16Rik, anticorps SS18L1, nBAF chromatin remodeling complex subunit, anticorps synovial sarcoma translocation gene on chromosome 18-like 1, anticorps synovial sarcoma translocation gene on chromosome 18-like 1 S homeolog, anticorps SS18, nBAF chromatin remodeling complex subunit like 1, anticorps SS18L1, anticorps ss18l1, anticorps ss18l1.S, anticorps Ss18l1

Sujet: Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X,18)(p11.2,q11.2), in which the 5-prime end of the SS18 gene is fused in-frame to the 3-prime end of the SSX1, SSX2, or SSX4 gene. The SS18L1 gene is homologous to SS18.

Poids moléculaire: 43 kDa (MW of target protein)