LETM2 anticorps (N-Term)

N° du produit ABIN632146

Cet anticorps Lapin Polyclonal détecte spécifiquement LETM2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour LETM2 anticorps (N-Term) (ABIN632146)

Antigène: LETM2 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 2 (LETM2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LETM2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LETM2 anticorps

Épitope: N-Term

Specificité: LETM2 antibody was raised against the N terminal of LETM2

Purification: Affinity purified

Immunogène: LETM2 antibody was raised using the N terminal of LETM2 corresponding to a region with amino acids KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LETM2 Blocking Peptide, (ABIN939964), is also available for use as a blocking control in assays to test for specificity of this LETM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LETM2

Antigène: LETM2 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 2 (LETM2))

Autre désignation: LETM2

Sujet: LETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.

Poids moléculaire: 45 kDa (MW of target protein)