LETM2 anticorps (N-Term)
-
- Antigène Voir toutes LETM2 Anticorps
- LETM2 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 2 (LETM2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LETM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LETM2 antibody was raised against the N terminal of LETM2
- Purification
- Affinity purified
- Immunogène
- LETM2 antibody was raised using the N terminal of LETM2 corresponding to a region with amino acids KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK
- Top Product
- Discover our top product LETM2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LETM2 Blocking Peptide, catalog no. 33R-4578, is also available for use as a blocking control in assays to test for specificity of this LETM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LETM2 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 2 (LETM2))
- Autre désignation
- LETM2 (LETM2 Produits)
- Synonymes
- anticorps 6030453H13, anticorps D030041N04Rik, anticorps LETM2S, anticorps leucine zipper and EF-hand containing transmembrane protein 2, anticorps leucine zipper-EF-hand containing transmembrane protein 2, anticorps LETM2, anticorps Letm2
- Sujet
- LETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.
- Poids moléculaire
- 45 kDa (MW of target protein)
-