Lipase I anticorps (Middle Region)

N° du produit ABIN632150

Détail du produit anti-Lipase I anticorps

Antigène: Lipase I (LIPI)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Lipase I est non-conjugé

Application: Western Blotting (WB)

Specificité: LIPI antibody was raised against the middle region of LIPI

Purification: Affinity purified

Immunogène: LIPI antibody was raised using the middle region of LIPI corresponding to a region with amino acids YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIPI Blocking Peptide, catalog no. 33R-10099, is also available for use as a blocking control in assays to test for specificity of this LIPI antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Lipase I

Antigène: Lipase I (LIPI)

Autre désignation: LIPI (LIPI Produits)

Synonymes: anticorps CT17, anticorps LPDL, anticorps PLA1C, anticorps lipi, anticorps lpdl, anticorps lpdlr, anticorps pla1b, anticorps pred5, anticorps mpa-pla1, anticorps D930038D03Rik, anticorps lpd1, anticorps Liph, anticorps lipase I, anticorps lipase, member H, anticorps lipase, member I, anticorps LIPI, anticorps liph, anticorps Lipi

Sujet: The protein encoded by this gene is a phospholipase that hydrolyzes phosphatidic acid to produce lysophosphatidic acid. The encoded protein, which can be inhibited by sodium vanadate, may be found exclusively in sperm. Defects in this gene are a cause of susceptibility to familial hypertrigliceridemia.

Poids moléculaire: 55 kDa (MW of target protein)