QRSL1 anticorps
-
- Antigène Voir toutes QRSL1 Anticorps
- QRSL1 (Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp QRSL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- QRSL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDT
- Top Product
- Discover our top product QRSL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
QRSL1 Blocking Peptide, catalog no. 33R-8956, is also available for use as a blocking control in assays to test for specificity of this QRSL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QRSL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- QRSL1 (Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1))
- Autre désignation
- QRSL1 (QRSL1 Produits)
- Synonymes
- anticorps 0929/02, anticorps CG6007, anticorps Dmel\\CG6007, anticorps bene, anticorps benedict, anticorps l(3)S092902, anticorps wu:fi03b10, anticorps GatA, anticorps 2700038P16Rik, anticorps C80053, anticorps Glutamyl-tRNA amidotransferase, subunit A, anticorps glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1, anticorps glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 L homeolog, anticorps GatA, anticorps qrsl1, anticorps qrsl1.L, anticorps QRSL1, anticorps Qrsl1
- Sujet
- The function of the QRSL1 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 57 kDa (MW of target protein)
-