EIF4ENIF1 anticorps (N-Term)
-
- Antigène Voir toutes EIF4ENIF1 Anticorps
- EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1 (EIF4ENIF1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF4ENIF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EIF4 ENIF1 antibody was raised against the N terminal of EIF4 NIF1
- Purification
- Affinity purified
- Immunogène
- EIF4 ENIF1 antibody was raised using the N terminal of EIF4 NIF1 corresponding to a region with amino acids TEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGI
- Top Product
- Discover our top product EIF4ENIF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF4ENIF1 Blocking Peptide, catalog no. 33R-9031, is also available for use as a blocking control in assays to test for specificity of this EIF4ENIF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 NIF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1 (EIF4ENIF1))
- Autre désignation
- EIF4ENIF1 (EIF4ENIF1 Produits)
- Synonymes
- anticorps RGD1560908, anticorps eif4enif1, anticorps MGC80355, anticorps EIF4ENIF1, anticorps wu:fd15a05, anticorps zgc:101646, anticorps MGC147579, anticorps 4E-T, anticorps Clast4, anticorps 2610509L04Rik, anticorps A930019J01Rik, anticorps AA410001, anticorps AU021239, anticorps D11Ertd166e, anticorps eukaryotic translation initiation factor 4E nuclear import factor 1, anticorps eukaryotic translation initiation factor 4E nuclear import factor 1 S homeolog, anticorps Eif4enif1, anticorps EIF4ENIF1, anticorps eif4enif1.S, anticorps eif4enif1
- Sujet
- The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic, its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 108 kDa (MW of target protein)
-