PPM1M anticorps

N° du produit ABIN632167

Détail du produit anti-PPM1M anticorps

Antigène: PPM1M (Protein Phosphatase 1M (PP2C Domain Containing) (PPM1M))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPM1M est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPM1 M antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPM1M Blocking Peptide, catalog no. 33R-8149, is also available for use as a blocking control in assays to test for specificity of this PPM1M antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPM1M

Antigène: PPM1M (Protein Phosphatase 1M (PP2C Domain Containing) (PPM1M))

Autre désignation: PPM1M (PPM1M Produits)

Synonymes: anticorps 2810423O19Rik, anticorps AW610647, anticorps C77250, anticorps PP2Ceta, anticorps PP2C-eta, anticorps PP2CE, anticorps protein phosphatase 1M, anticorps protein phosphatase, Mg2+/Mn2+ dependent 1M, anticorps Ppm1m, anticorps PPM1M

Sujet: PPM1M belongs to the PP2C family. It contains 1 PP2C-like domain. The exact function of PPM1M is not known.

Poids moléculaire: 27 kDa (MW of target protein)