DNAJB1 anticorps

N° du produit ABIN632179

Cet anticorps Lapin Polyclonal détecte spécifiquement DNAJB1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour DNAJB1 anticorps (ABIN632179)

Antigène: DNAJB1 (DnaJ (Hsp40) Homolog, Subfamily B, Member 1 (DNAJB1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNAJB1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DNAJB1 anticorps

Purification: Affinity purified

Immunogène: DNAJB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNAJB1 Blocking Peptide, (ABIN938950), is also available for use as a blocking control in assays to test for specificity of this DNAJB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNAJB1

Antigène: DNAJB1 (DnaJ (Hsp40) Homolog, Subfamily B, Member 1 (DNAJB1))

Autre désignation: DNAJB1

Sujet: DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.

Poids moléculaire: 38 kDa (MW of target protein)