DNAJB1 anticorps
-
- Antigène Voir toutes DNAJB1 Anticorps
- DNAJB1 (DnaJ (Hsp40) Homolog, Subfamily B, Member 1 (DNAJB1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DNAJB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DNAJB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE
- Top Product
- Discover our top product DNAJB1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DNAJB1 Blocking Peptide, catalog no. 33R-3564, is also available for use as a blocking control in assays to test for specificity of this DNAJB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DNAJB1 (DnaJ (Hsp40) Homolog, Subfamily B, Member 1 (DNAJB1))
- Autre désignation
- DNAJB1 (DNAJB1 Produits)
- Synonymes
- anticorps HSPF1, anticorps Hdj1, anticorps Hsp40, anticorps RSPH16B, anticorps Sis1, anticorps CG10578, anticorps DNAJ-1, anticorps DNAJ1, anticorps DROJ1, anticorps Dmel\\CG10578, anticorps DnaJ1 64EF, anticorps DroJ1, anticorps EU3500, anticorps HSP40, anticorps HSP40/HDJ1, anticorps Hsp-40, anticorps anon-WO0140519.166, anticorps anon-WO0172774.135, anticorps dHDJ1, anticorps dHDJ1/HSP40, anticorps dHdj1, anticorps dhdJ1, anticorps dhdj-1, anticorps dhdj1, anticorps dnaJ-1, anticorps droj1, anticorps hsp40, anticorps dnajb4, anticorps hdj1, anticorps hspf1, anticorps sis1, anticorps DnaJ-5, anticorps MAS5, anticorps dnaJ, anticorps 0610007I11Rik, anticorps dnajb1, anticorps zf-Hsp40, anticorps zgc:101068, anticorps DnaJ heat shock protein family (Hsp40) member B1, anticorps DnaJ-like-1, anticorps DnaJ (Hsp40) homolog 5, anticorps type I HSP40 co-chaperone YDJ1, anticorps DnaJ protein, anticorps molecular chaperone DnaJ, anticorps DnaJ (Hsp40) homolog, subfamily B, member 1a, anticorps DNAJB1, anticorps Dnajb1, anticorps DnaJ-1, anticorps dnajb1, anticorps DnaJ-5, anticorps YDJ1, anticorps dnaJ, anticorps dnajb1a
- Sujet
- DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.
- Poids moléculaire
- 38 kDa (MW of target protein)
-