EPB42 anticorps (Middle Region)

N° du produit ABIN632184

Détail du produit anti-EPB42 anticorps

Antigène: EPB42 (erythrocyte Membrane Protein Band 4.2 (EPB42))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPB42 est non-conjugé

Application: Western Blotting (WB)

Specificité: EPB42 antibody was raised against the middle region of EPB42

Purification: Affinity purified

Immunogène: EPB42 antibody was raised using the middle region of EPB42 corresponding to a region with amino acids ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EPB42 Blocking Peptide, catalog no. 33R-4166, is also available for use as a blocking control in assays to test for specificity of this EPB42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPB42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EPB42

Antigène: EPB42 (erythrocyte Membrane Protein Band 4.2 (EPB42))

Autre désignation: EPB42 (EPB42 Produits)

Synonymes: anticorps PA, anticorps SPH5, anticorps Epb4.2, anticorps Epb42, anticorps erythrocyte membrane protein band 4.2, anticorps EPB42, anticorps Epb42

Sujet: Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia.

Poids moléculaire: 80 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis