ST14 anticorps
-
- Antigène Voir toutes ST14 Anticorps
- ST14 (Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ST14 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids RHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEV
- Top Product
- Discover our top product ST14 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ST14 Blocking Peptide, catalog no. 33R-7953, is also available for use as a blocking control in assays to test for specificity of this ST14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ST14 (Suppression of Tumorigenicity 14 (Colon Carcinoma) (ST14))
- Autre désignation
- ST14 (ST14 Produits)
- Synonymes
- anticorps HAI, anticorps MT-SP1, anticorps MTSP1, anticorps PRSS14, anticorps SNC19, anticorps TADG15, anticorps TMPRSS14, anticorps XMT-SP1, anticorps hai, anticorps mt-sp1, anticorps mtsp1, anticorps prss14, anticorps snc19, anticorps st14, anticorps st14a, anticorps tadg15, anticorps tmprss1, anticorps Epithin, anticorps Prss14, anticorps Tmprss14, anticorps mCAP3, anticorps matriptase, anticorps suppression of tumorigenicity 14, anticorps suppression of tumorigenicity 14 L homeolog, anticorps suppression of tumorigenicity 14 (colon carcinoma), anticorps ST14, anticorps st14.L, anticorps St14
- Sujet
- ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.
- Poids moléculaire
- 95 kDa (MW of target protein)
-