TNFAIP8L1 anticorps (Middle Region)
-
- Antigène Tous les produits TNFAIP8L1
- TNFAIP8L1 (Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TNFAIP8L1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TNFAIP8 L1 antibody was raised against the middle region of TNFAIP8 1
- Purification
- Affinity purified
- Immunogène
- TNFAIP8 L1 antibody was raised using the middle region of TNFAIP8 1 corresponding to a region with amino acids AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TNFAIP8L1 Blocking Peptide, catalog no. 33R-1311, is also available for use as a blocking control in assays to test for specificity of this TNFAIP8L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFAIP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TNFAIP8L1 (Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1))
- Autre désignation
- TNFAIP8L1 (TNFAIP8L1 Produits)
- Synonymes
- anticorps TIPE1, anticorps 2600017J23Rik, anticorps TNF alpha induced protein 8 like 1, anticorps tumor necrosis factor, alpha-induced protein 8-like 1, anticorps TNFAIP8L1, anticorps Tnfaip8l1
- Sujet
- TNFAIP8L1 belongs to the TNFAIP8 family. The exact function of TNFAIP8L is not known.
- Poids moléculaire
- 21 kDa (MW of target protein)
-