ZSWIM3 anticorps (N-Term)
-
- Antigène Tous les produits ZSWIM3
- ZSWIM3 (Zinc Finger, SWIM-Type Containing 3 (ZSWIM3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZSWIM3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ZSWIM3 antibody was raised against the N terminal of ZSWIM3
- Purification
- Affinity purified
- Immunogène
- ZSWIM3 antibody was raised using the N terminal of ZSWIM3 corresponding to a region with amino acids SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZSWIM3 Blocking Peptide, catalog no. 33R-8928, is also available for use as a blocking control in assays to test for specificity of this ZSWIM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZSWIM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ZSWIM3 (Zinc Finger, SWIM-Type Containing 3 (ZSWIM3))
- Autre désignation
- ZSWIM3 (ZSWIM3 Produits)
- Synonymes
- anticorps 4921517A06Rik, anticorps C86566, anticorps C20orf164, anticorps zinc finger SWIM-type containing 3, anticorps zinc finger, SWIM-type containing 3, anticorps ZSWIM3, anticorps Zswim3
- Sujet
- The function of ZSWIM3 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 77 kDa (MW of target protein)
-