FAM45B anticorps (Middle Region)

N° du produit ABIN632226

Détail du produit anti-FAM45B anticorps

Antigène: FAM45B (Family with Sequence Similarity 45, Member B (Pseudogene) (FAM45B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM45B est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM45 B antibody was raised against the middle region of FAM45

Purification: Affinity purified

Immunogène: FAM45 B antibody was raised using the middle region of FAM45 corresponding to a region with amino acids AEDPEKSESQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM45B Blocking Peptide, catalog no. 33R-1121, is also available for use as a blocking control in assays to test for specificity of this FAM45B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM45B

Antigène: FAM45B (Family with Sequence Similarity 45, Member B (Pseudogene) (FAM45B))

Autre désignation: FAM45B (FAM45B Produits)

Synonymes: anticorps HT011, anticorps family with sequence similarity 45, member A pseudogene, anticorps FAM45BP

Sujet: The function of FAM45 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 40 kDa (MW of target protein)