CSNK1G3 anticorps (Middle Region)
-
- Antigène Voir toutes CSNK1G3 Anticorps
- CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CSNK1G3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CK1 gamma 3 antibody was raised against the middle region of CSNK1 G3
- Purification
- Affinity purified
- Immunogène
- CK1 gamma 3 antibody was raised using the middle region of CSNK1 G3 corresponding to a region with amino acids LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
- Top Product
- Discover our top product CSNK1G3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CK1 gamma 3 Blocking Peptide, catalog no. 33R-4875, is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))
- Autre désignation
- CK1 gamma 3 (CSNK1G3 Produits)
- Synonymes
- anticorps CKI-gamma 3, anticorps CSNK1G3L, anticorps 3300002K07Rik, anticorps C330049O21Rik, anticorps casein kinase 1 gamma 3, anticorps casein kinase 1 gamma 3 L homeolog, anticorps casein kinase 1, gamma 3, anticorps CSNK1G3, anticorps csnk1g3, anticorps csnk1g3.L, anticorps Csnk1g3
- Sujet
- Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1G3 can phosphorylate a large number of proteins. It participates in Wnt signaling.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- Signalisation Hedgehog
-