CSNK1G3 anticorps (Middle Region)

N° du produit ABIN632247

Cet anticorps anti-CSNK1G3 Polyclonal Lapin (ABIN632247) détecte spécifiquement CSNK1G3 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour CSNK1G3 anticorps (Middle Region) (ABIN632247)

Antigène: CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSNK1G3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CSNK1G3 anticorps

Épitope: Middle Region

Specificité: CK1 gamma 3 antibody was raised against the middle region of CSNK1 G3

Purification: Affinity purified

Immunogène: CK1 gamma 3 antibody was raised using the middle region of CSNK1 G3 corresponding to a region with amino acids LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CK1 gamma 3 Blocking Peptide, (ABIN940261), is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSNK1G3

Antigène: CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))

Autre désignation: CK1 gamma 3

Sujet: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1G3 can phosphorylate a large number of proteins. It participates in Wnt signaling.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Signalisation Hedgehog