VPS54 anticorps
-
- Antigène Voir toutes VPS54 Anticorps
- VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VPS54 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR
- Top Product
- Discover our top product VPS54 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VPS54 Blocking Peptide, catalog no. 33R-3139, is also available for use as a blocking control in assays to test for specificity of this VPS54 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS54 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))
- Autre désignation
- VPS54 (VPS54 Produits)
- Synonymes
- anticorps 5330404P15Rik, anticorps Hcc8, anticorps Vps54l, anticorps mSLP8, anticorps wr, anticorps HCC8, anticorps SLP-8p, anticorps VPS54L, anticorps WR, anticorps hVps54L, anticorps Vsp54, anticorps Vacuolar protein sorting-associated protein 54, anticorps VPS54 GARP complex subunit, anticorps VPS54, GARP complex subunit, anticorps vps-54, anticorps Vps54, anticorps VPS54
- Sujet
- VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi.
- Poids moléculaire
- 107 kDa (MW of target protein)
-