VPS54 anticorps

N° du produit ABIN632263

Cet anticorps Lapin Polyclonal détecte spécifiquement VPS54 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour VPS54 anticorps (ABIN632263)

Antigène: VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPS54 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-VPS54 anticorps

Purification: Affinity purified

Immunogène: VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPS54 Blocking Peptide, (ABIN938525), is also available for use as a blocking control in assays to test for specificity of this VPS54 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPS54

Antigène: VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))

Autre désignation: VPS54

Sujet: VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi.

Poids moléculaire: 107 kDa (MW of target protein)