GRAP anticorps (Middle Region)

N° du produit ABIN632276

Détail du produit anti-GRAP anticorps

Antigène: GRAP (GRB2-Related Adaptor Protein (GRAP))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRAP est non-conjugé

Application: Western Blotting (WB)

Specificité: GRAP antibody was raised against the middle region of GRAP

Purification: Affinity purified

Immunogène: GRAP antibody was raised using the middle region of GRAP corresponding to a region with amino acids KRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GRAP Blocking Peptide, catalog no. 33R-4634, is also available for use as a blocking control in assays to test for specificity of this GRAP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GRAP

Antigène: GRAP (GRB2-Related Adaptor Protein (GRAP))

Autre désignation: GRAP (GRAP Produits)

Synonymes: anticorps 8430435N19Rik, anticorps BB233594, anticorps GRAP, anticorps grap, anticorps zgc:110202, anticorps MGC109892, anticorps si:dkeyp-9d4.1, anticorps Grap, anticorps GRB2-related adaptor protein, anticorps GRB2-related adapter protein, anticorps GRB2-related adaptor protein a, anticorps GRB2-related adaptor protein b, anticorps GRAP, anticorps Grap, anticorps LOC489534, anticorps grapa, anticorps grapb, anticorps LOC100727005

Sujet: This gene encodes a member of the GRB2/Sem5/Drk family. This member functions as a cytoplasmic signaling protein which contains an SH2 domain flanked by two SH3 domains. The SH2 domain interacts with ligand-activated receptors for stem cell factor and erythropoietin, and facilitates the formation of a stable complex with the BCR-ABL oncoprotein. This protein also associates with the Ras guanine nucleotide exchange factor SOS1 (son of sevenless homolog 1) through its N-terminal SH3 domain.

Poids moléculaire: 25 kDa (MW of target protein)