GRIPAP1 anticorps (N-Term)

N° du produit ABIN632287

Détail du produit anti-GRIPAP1 anticorps

Antigène: GRIPAP1 (GRIP1 Associated Protein 1 (GRIPAP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRIPAP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GRIPAP1 antibody was raised against the N terminal of GRIPAP1

Purification: Affinity purified

Immunogène: GRIPAP1 antibody was raised using the N terminal of GRIPAP1 corresponding to a region with amino acids ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GRIPAP1 Blocking Peptide, catalog no. 33R-2618, is also available for use as a blocking control in assays to test for specificity of this GRIPAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIPAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GRIPAP1

Antigène: GRIPAP1 (GRIP1 Associated Protein 1 (GRIPAP1))

Autre désignation: GRIPAP1 (GRIPAP1 Produits)

Synonymes: anticorps gripap1, anticorps MGC184827, anticorps zgc:158787, anticorps GRASP-1, anticorps AI854681, anticorps DXImx47e, anticorps Sfc10, anticorps mKIAA1167, anticorps Grasp1, anticorps GRIP1 associated protein 1, anticorps gripap1, anticorps GRIPAP1, anticorps Gripap1

Sujet: This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms, however, the full-length nature and biological validity of all of these variants have not been determined.

Poids moléculaire: 96 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome