ASB7 anticorps (Middle Region)

N° du produit ABIN632314

Détail du produit anti-ASB7 anticorps

Antigène: ASB7 (Ankyrin Repeat and SOCS Box Containing 7 (ASB7))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASB7 est non-conjugé

Application: Western Blotting (WB)

Specificité: ASB7 antibody was raised against the middle region of ASB7

Purification: Affinity purified

Immunogène: ASB7 antibody was raised using the middle region of ASB7 corresponding to a region with amino acids QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASB7 Blocking Peptide, catalog no. 33R-7760, is also available for use as a blocking control in assays to test for specificity of this ASB7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASB7

Antigène: ASB7 (Ankyrin Repeat and SOCS Box Containing 7 (ASB7))

Autre désignation: ASB7 (ASB7 Produits)

Synonymes: anticorps AI449039, anticorps Asb-7, anticorps D030055C23Rik, anticorps asb7, anticorps zgc:77381, anticorps ASB-7, anticorps ankyrin repeat and SOCS box containing 7, anticorps ankyrin repeat and SOCS box-containing 7, anticorps ankyrin repeat and SOCS box containing 7 L homeolog, anticorps ASB7, anticorps Asb7, anticorps asb7.L, anticorps asb7

Sujet: The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquination and, therefore, for proteasome-mediated degradation. Two alternative transcripts encoding different isoforms have been described.

Poids moléculaire: 36 kDa (MW of target protein)