Plastin 3 anticorps

N° du produit ABIN632329

Détail du produit anti-Plastin 3 anticorps

Antigène: Plastin 3 (PLS3)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Plastin 3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Plastin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Plastin 3 Blocking Peptide, catalog no. 33R-8170, is also available for use as a blocking control in assays to test for specificity of this Plastin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Plastin 3

Antigène: Plastin 3 (PLS3)

Autre désignation: Plastin 3 (PLS3 Produits)

Synonymes: anticorps T-plastin, anticorps AI115446, anticorps AL024105, anticorps T-fimbrin, anticorps MGC68681, anticorps t-plastin, anticorps MGC106020, anticorps DKFZp459D0939, anticorps PLS3, anticorps Plastin-3, anticorps wu:fc04g03, anticorps zgc:91903, anticorps plastin 3, anticorps plastin 3 (T-isoform), anticorps plastin 3 L homeolog, anticorps plastin 3 (T isoform), anticorps PLS3, anticorps Pls3, anticorps pls3.L, anticorps pls3

Sujet: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.

Poids moléculaire: 71 kDa (MW of target protein)