Plastin 3 anticorps

N° du produit ABIN632329

Cet anticorps Lapin Polyclonal détecte spécifiquement Plastin 3 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Plastin 3 anticorps (ABIN632329)

Antigène: Plastin 3 (PLS3)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Plastin 3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Plastin 3 anticorps

Purification: Affinity purified

Immunogène: Plastin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Plastin 3 Blocking Peptide, (ABIN5615406), is also available for use as a blocking control in assays to test for specificity of this Plastin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Plastin 3

Antigène: Plastin 3 (PLS3)

Autre désignation: Plastin 3

Sujet: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.

Poids moléculaire: 71 kDa (MW of target protein)