CTF18 anticorps

N° du produit ABIN632332

Détail du produit anti-CTF18 anticorps

Antigène: CTF18 (CHTF18) (CTF18, Chromosome Transmission Fidelity Factor 18 Homolog (CHTF18))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CTF18 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CHTF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHTF18 Blocking Peptide, catalog no. 33R-8631, is also available for use as a blocking control in assays to test for specificity of this CHTF18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHTF18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CTF18

Antigène: CTF18 (CHTF18) (CTF18, Chromosome Transmission Fidelity Factor 18 Homolog (CHTF18))

Autre désignation: CHTF18 (CHTF18 Produits)

Synonymes: anticorps CHTF18, anticorps zgc:113153, anticorps MGC81266, anticorps 6030457M03Rik, anticorps CTF18, anticorps Chl12, anticorps C16orf41, anticorps C321D2.2, anticorps C321D2.3, anticorps C321D2.4, anticorps CHL12, anticorps Ctf18, anticorps RUVBL, anticorps chromosome transmission fidelity factor 18, anticorps CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae), anticorps chromosome transmission fidelity factor 18 L homeolog, anticorps chromosome transmission fidelity protein 18 homolog, anticorps CTF18, chromosome transmission fidelity factor 18, anticorps Chtf18, anticorps CHTF18, anticorps chtf18, anticorps chtf18.L, anticorps LOC726742, anticorps LOC100160476, anticorps LOC100433034, anticorps LOC100442428, anticorps LOC100632105, anticorps LOC100642927

Sujet: CHTF18, CHTF8, and DCC1 are components of an alternative replication factor C (RFC) complex that loads PCNA onto DNA during S phase of the cell cycle.

Poids moléculaire: 107 kDa (MW of target protein)