serine Dehydratase anticorps (Middle Region)

N° du produit ABIN632335

Cet anticorps Lapin Polyclonal détecte spécifiquement serine Dehydratase dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour serine Dehydratase anticorps (Middle Region) (ABIN632335)

Antigène: serine Dehydratase (SDS)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp serine Dehydratase est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-serine Dehydratase anticorps

Épitope: Middle Region

Specificité: SDS antibody was raised against the middle region of SDS

Purification: Affinity purified

Immunogène: SDS antibody was raised using the middle region of SDS corresponding to a region with amino acids KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SDS Blocking Peptide, (ABIN939832), is also available for use as a blocking control in assays to test for specificity of this SDS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur serine Dehydratase

Antigène: serine Dehydratase (SDS)

Autre désignation: SDS

Sujet: This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly