DCTPP1 anticorps (Middle Region)
-
- Antigène Voir toutes DCTPP1 Anticorps
- DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DCTPP1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- XTP3 TPA antibody was raised against the middle region of XTP3 PA
- Purification
- Affinity purified
- Immunogène
- XTP3 TPA antibody was raised using the middle region of XTP3 PA corresponding to a region with amino acids KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
- Top Product
- Discover our top product DCTPP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
XTP3TPA Blocking Peptide, catalog no. 33R-4552, is also available for use as a blocking control in assays to test for specificity of this XTP3TPA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XTP0 PA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))
- Autre désignation
- XTP3TPA (DCTPP1 Produits)
- Synonymes
- anticorps RS21C6, anticorps XTP3TPA, anticorps 2410015N17Rik, anticorps AI854235, anticorps RS21-C6, anticorps Rs21c6, anticorps Xtp3tpa, anticorps xtp3tpa, anticorps dCTP pyrophosphatase 1, anticorps dCTP pyrophosphatase 1 L homeolog, anticorps DCTPP1, anticorps Dctpp1, anticorps dctpp1.L, anticorps dctpp1
- Sujet
- XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity and pyrimidine deoxyribonucleotide binding.
- Poids moléculaire
- 19 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-