KIF5C anticorps (N-Term)
-
- Antigène Voir toutes KIF5C Anticorps
- KIF5C (Kinesin Family Member 5C (KIF5C))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KIF5C est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIF5 C antibody was raised against the N terminal of KIF5
- Purification
- Affinity purified
- Immunogène
- KIF5 C antibody was raised using the N terminal of KIF5 corresponding to a region with amino acids ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDR
- Top Product
- Discover our top product KIF5C Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIF5C Blocking Peptide, catalog no. 33R-1099, is also available for use as a blocking control in assays to test for specificity of this KIF5C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KIF5C (Kinesin Family Member 5C (KIF5C))
- Autre désignation
- KIF5C (KIF5C Produits)
- Synonymes
- anticorps KIF5C, anticorps LOC100218538, anticorps KINN, anticorps NKHC, anticorps NKHC-2, anticorps NKHC2, anticorps Khc, anticorps si:ch211-157c24.3, anticorps kinesin family member 5C, anticorps KIF5C, anticorps kif5c, anticorps Kif5c
- Sujet
- KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.
- Poids moléculaire
- 109 kDa (MW of target protein)
-