VPS52 anticorps

N° du produit ABIN632392

Détail du produit anti-VPS52 anticorps

Antigène: VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPS52 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: VPS52 antibody was raised using a synthetic peptide corresponding to a region with amino acids RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPS52 Blocking Peptide, catalog no. 33R-8283, is also available for use as a blocking control in assays to test for specificity of this VPS52 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS52 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPS52

Antigène: VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))

Autre désignation: VPS52 (VPS52 Produits)

Synonymes: anticorps ARE1, anticorps RP5-1033B10, anticorps SAC2, anticorps SACM2L, anticorps dJ1033B10.5, anticorps Are1, anticorps Sacm2l, anticorps D130068D18, anticorps D430041K17Rik, anticorps fb94c11, anticorps sacm2l, anticorps wu:fb94c11, anticorps VPS52, GARP complex subunit, anticorps VPS52 GARP complex subunit, anticorps vacuolar protein sorting 52 homolog (S. cerevisiae), anticorps VPS52, anticorps Vps52, anticorps vps52

Sujet: This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.

Poids moléculaire: 82 kDa (MW of target protein)