C1orf43 anticorps (Middle Region)
-
- Antigène Tous les produits C1orf43
- C1orf43 (Chromosome 1 Open Reading Frame 43 (C1orf43))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C1orf43 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C1 ORF43 antibody was raised against the middle region of C1 rf43
- Purification
- Affinity purified
- Immunogène
- C1 ORF43 antibody was raised using the middle region of C1 rf43 corresponding to a region with amino acids YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQ
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C1ORF43 Blocking Peptide, catalog no. 33R-10211, is also available for use as a blocking control in assays to test for specificity of this C1ORF43 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF43 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C1orf43 (Chromosome 1 Open Reading Frame 43 (C1orf43))
- Autre désignation
- C1ORF43 (C1orf43 Produits)
- Synonymes
- anticorps NICE-3, anticorps NS5ATP4, anticorps S863-3, anticorps c1orf43, anticorps chromosome 1 open reading frame 43, anticorps chromosome 1 open reading frame 43 L homeolog, anticorps C1orf43, anticorps c1orf43.L
- Sujet
- The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 29 kDa (MW of target protein)
-