HSPA6 anticorps

N° du produit ABIN632402

Détail du produit anti-HSPA6 anticorps

Antigène: HSPA6 (Heat Shock 70kDa Protein 6 (HSP70B') (HSPA6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPA6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HSPA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA6 Blocking Peptide, catalog no. 33R-2819, is also available for use as a blocking control in assays to test for specificity of this HSPA6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPA6

Antigène: HSPA6 (Heat Shock 70kDa Protein 6 (HSP70B') (HSPA6))

Autre désignation: HSPA6 (HSPA6 Produits)

Synonymes: anticorps HSPA6, anticorps HSP70B', anticorps heat shock protein family A (Hsp70) member 6, anticorps HSPA6

Sujet: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognise nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Poids moléculaire: 71 kDa (MW of target protein)