Lactate Dehydrogenase A anticorps (Middle Region)

N° du produit ABIN632424

Détail du produit anti-Lactate Dehydrogenase A anticorps

Antigène: Lactate Dehydrogenase A (LDHA)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Lactate Dehydrogenase A est non-conjugé

Application: Western Blotting (WB)

Specificité: LDHA antibody was raised against the middle region of LDHA

Purification: Affinity purified

Immunogène: LDHA antibody was raised using the middle region of LDHA corresponding to a region with amino acids PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LDHA Blocking Peptide, catalog no. 33R-7206, is also available for use as a blocking control in assays to test for specificity of this LDHA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Lactate Dehydrogenase A

Antigène: Lactate Dehydrogenase A (LDHA)

Autre désignation: LDHA (LDHA Produits)

Synonymes: anticorps GSD11, anticorps LDH1, anticorps LDHM, anticorps LDH-M, anticorps ldh-h, anticorps ldha, anticorps ldha-B, anticorps ldhbb, anticorps trg-5, anticorps Ldh1, anticorps Ldhm, anticorps l7R2, anticorps gsd11, anticorps ldh-m, anticorps ldh1, anticorps ldhm, anticorps pig19, anticorps ldha1, anticorps ldhab, anticorps LDH-A, anticorps LDHC, anticorps lactate dehydrogenase A, anticorps lactate dehydrogenase B L homeolog, anticorps lactate dehydrogenase A4, anticorps lactate dehydrogenase A L homeolog, anticorps L-lactate dehydrogenase A chain, anticorps LDHA, anticorps ldhb.L, anticorps Ldha, anticorps ldha, anticorps ldha.L, anticorps LOC100713875

Sujet: LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: L'effet Warburg