Kallikrein 2 anticorps (Middle Region)

N° du produit ABIN632433

Détail du produit anti-Kallikrein 2 anticorps

Antigène: Kallikrein 2 (KLK2)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Kallikrein 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: KLK2 antibody was raised against the middle region of KLK2

Purification: Affinity purified

Immunogène: KLK2 antibody was raised using the middle region of KLK2 corresponding to a region with amino acids KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLK2 Blocking Peptide, catalog no. 33R-4419, is also available for use as a blocking control in assays to test for specificity of this KLK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Kallikrein 2

Antigène: Kallikrein 2 (KLK2)

Autre désignation: KLK2 (KLK2 Produits)

Synonymes: anticorps KLK2A2, anticorps hGK-1, anticorps hK2, anticorps KLK2, anticorps Ton, anticorps rGK-2, anticorps Klk2, anticorps kallikrein related peptidase 2, anticorps kallikrein-related peptidase 2, anticorps kallikrein-2, anticorps kallikrein 1-related peptidase C2, anticorps KLK2, anticorps LOC748637, anticorps Klk1c2, anticorps LOC100716976

Sujet: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Système du Complément